Loading...
Statistics
Advertisement

qieg.com - Informationen zum Thema science dating.
www.qieg.com/
qieg.com

Qieg.com

Advertisement
Qieg.com is hosted in United States / Cambridge . Qieg.com uses HTTPS protocol. Number of used technologies: 4. First technologies: Html, Html5, Javascript, Number of used javascripts: 3. First javascripts: Jquery-1.11.3.custom.min.js, Caf.js, Iam.js, Number of used analytics tools: 0. Its server type is: Apache/2.2.22 (Debian).

Technologies in use by Qieg.com

Technology

Number of occurences: 4
  • Html
  • Html5
  • Javascript
  • Php

Advertisement

Javascripts

Number of occurences: 3
  • jquery-1.11.3.custom.min.js
  • caf.js
  • iam.js

Advertise

Number of occurences: 1
  • Google Adsense

Server Type

  • Apache/2.2.22 (Debian)

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Qieg.com

SSL certificate

    • name: /OU=Domain Control Validated/CN=cc.sedoparking.com
    • subject:
      • OU: Domain Control Validated
      • CN: cc.sedoparking.com
    • hash: 75a61910
    • issuer:
      • C: BE
      • O: GlobalSign nv-sa
      • CN: GlobalSign Domain Validation CA - SHA256 - G2
    • version: 2
    • serialNumber: 1492334156563186506134045474198837599565904
    • validFrom: 151111084540Z
    • validTo: 171111084540Z
    • validFrom_time_t: 1447231540
    • validTo_time_t: 1510389940
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • certificatePolicies: Policy: 2.23.140.1.2.1 CPS: https://www.globalsign.com/repository/
      • subjectAltName: DNS:cc.sedoparking.com
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • crlDistributionPoints: Full Name: URI:http://crl.globalsign.com/gs/gsdomainvalsha2g2.crl
      • authorityInfoAccess: CA Issuers - URI:http://secure.globalsign.com/cacert/gsdomainvalsha2g2r1.crt OCSP - URI:http://ocsp2.globalsign.com/gsdomainvalsha2g2
      • subjectKeyIdentifier: 0E:6F:EB:0F:FC:4B:CA:2F:04:C5:FE:DC:1B:B8:A5:5F:31:E1:C3:6A
      • authorityKeyIdentifier: keyid:EA:4E:7C:D4:80:2D:E5:15:81:86:26:8C:82:6D:C0:98:A4:CF:97:0F

Meta - Qieg.com

Number of occurences: 5
  • Name:
    Content: 0; url=http://www.qieg.com//?gtnjs=1
  • Name: GOOGLEBOT
    Content: index, follow, all
  • Name: robots
    Content: index, follow, all
  • Name: viewport
    Content: width=device-width,initial-scale=1,maximum-scale=1,user-scalable=0
  • Name: description
    Content: qieg.com

Server / Hosting

  • IP: 72.52.4.119
  • Latitude: 42.36
  • Longitude: -71.08
  • Country: United States
  • City: Cambridge

Rname

  • ns1.sedoparking.com
  • ns2.sedoparking.com
  • mail.nickstel.com

Target

  • hostmaster.sedo.de

HTTP Header Response

HTTP/1.1 200 OK Date: Tue, 07 Jun 2016 13:40:04 GMT Server: Apache/2.2.22 (Debian) Expires: Mon, 26 Jul 1997 05:00:00 GMT Last-Modified: Tue, 07 Jun 2016 13:40:04 GMT Cache-Control: no-store, no-cache, must-revalidate Cache-Control: post-check=0, pre-check=0 Pragma: no-cache Vary: Accept-Encoding Content-Type: text/html; charset=UTF-8 X-Cache: MISS from 550555 nnCoection: close Set-Cookie: NSC_tfep-83+63+5+220-91=ffffffff516a73d445525d5f4f58455e445a4a423660;path=/;httponly X-Cache: MISS from s_bd39 X-Cache-Lookup: MISS from s_bd39:80 Via: 1.1 s_bd39 (squid/3.5.19) Connection: keep-alive

DNS

host: qieg.com
  1. class: IN
  2. ttl: 600
  3. type: A
  4. ip: 72.52.4.119
host: qieg.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.sedoparking.com
host: qieg.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.sedoparking.com
host: qieg.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.sedoparking.com
  5. rname: hostmaster.sedo.de
  6. serial: 2015071001
  7. refresh: 86400
  8. retry: 10800
  9. expire: 604800
  10. minimum-ttl: 86400
host: qieg.com
  1. class: IN
  2. ttl: 421
  3. type: MX
  4. pri: 0
  5. target: mail.nickstel.com
host: qieg.com
  1. class: IN
  2. ttl: 3600
  3. type: TXT
  4. txt: v=spf1 ip6:fd92:59f3:510e::/48 -all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.ieg.com, www.qeieg.com, www.eieg.com, www.qrieg.com, www.rieg.com, www.qvieg.com, www.vieg.com, www.qbieg.com, www.bieg.com, www.qnieg.com, www.nieg.com, www.qfieg.com, www.fieg.com, www.qgieg.com, www.gieg.com, www.qhieg.com, www.hieg.com, www.qyieg.com, www.yieg.com, www.qeg.com, www.qireg.com, www.qreg.com, www.qifeg.com, www.qfeg.com, www.qiveg.com, www.qveg.com, www.qikeg.com, www.qkeg.com, www.qi,eg.com, www.q,eg.com, www.qibeg.com, www.qbeg.com, www.qigeg.com, www.qgeg.com, www.qiteg.com, www.qteg.com, www.qiyeg.com, www.qyeg.com, www.qiueg.com, www.queg.com, www.qijeg.com, www.qjeg.com, www.qimeg.com, www.qmeg.com, www.qineg.com, www.qneg.com, www.qig.com, www.qiexg.com, www.qixg.com, www.qiesg.com, www.qisg.com, www.qiewg.com, www.qiwg.com, www.qierg.com, www.qirg.com, www.qiefg.com, www.qifg.com, www.qievg.com, www.qivg.com, www.qiecg.com, www.qicg.com, www.qieqg.com, www.qiqg.com, www.qieag.com, www.qiag.com, www.qieyg.com, www.qiyg.com, www.qie.com, www.qiegs.com, www.qies.com, www.qiegx.com, www.qiex.com, www.qiegy.com, www.qiey.com, www.qiegh.com, www.qieh.com, www.qiegn.com, www.qien.com, www.qiegc.com, www.qiec.com, www.qiegd.com, www.qied.com, www.qiege.com, www.qiee.com, www.qiegr.com, www.qier.com, www.qiegt.com, www.qiet.com, www.qiegb.com, www.qieb.com, www.qiegv.com, www.qiev.com,

Other websites we recently analyzed

  1. vuki.science
    Austin (United States) - 209.99.40.219
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  2. Huron Valley Cabling and Consulting
    Business for Telephone and Computer Cabling
    Mountain View (United States) - 74.125.206.121
    Server software: ghs
    Technology: CSS, Html, Javascript
    Number of Javascript: 1
    Number of meta tags: 3
  3. physiciansadvancedfitnessmedicine.com
    Provo (United States) - 198.57.247.164
    Server software: nginx/1.10.1
    Technology: Html
    Number of meta tags: 2
  4. Sie werden weitergeleitet auf
    Germany - 134.119.245.118
    Server software: Apache/2.4.20
    Technology: Php
    Number of meta tags: 1
  5. lifestyle-urlaub
    Germany - 91.198.157.170
    G Analytics ID: UA-9440081-33
    Server software: Apache/2.2.21 (Win32) PHP/5.3.8 mod_perl/2.0.4 Perl/v5.10.1
    Technology: Html, Google Analytics
    Number of meta tags: 3
  6. czxtx.com
    Hong Kong - 103.61.240.87
    Server software: Microsoft-IIS/6.0
    Technology: Html, Html5, Javascript
    Number of meta tags: 1
  7. orangesunteamwear.net
    Switzerland - 141.8.224.25
    Server software: Apache
    Technology: Google Adsense, CSS, Html, Javascript, Php
    Number of Javascript: 4
    Number of meta tags: 2
  8. Affordable Car Care Auto Repair Walton Hills Ohio
    Affordable Car Care is a family owned business delivering honest & professional auto repair & maintenance services to the people of Walton Hills, Macedonia, Sagamore Hills, Northfield, Solon, and surrounding areas.
    Phoenix (United States) - 69.50.216.99
    Server software: Apache
    Technology: CSS, Html, Javascript, Share This Social Media Buttons
    Number of Javascript: 4
    Number of meta tags: 4
  9. Fastshop 24
    Shop powered by PrestaShop
    Germany - 82.165.104.11
    Server software: Apache
    Technology: CSS, Html, Javascript, Php, Prestashop
    Number of Javascript: 12
    Number of meta tags: 5
  10. barristar.com
    Frankfurt (Germany) - 149.126.77.76
    Server software:
    Technology: Html, Iframe, Incapsula
    Number of meta tags: 1

Check Other Websites